- Recombinant Serpentine receptor class H-72 (srh-72)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1112983
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 38,745 Da
- E Coli or Yeast
- 1-344
- Serpentine receptor class H-72 (srh-72)
Sequence
MSEASLSTYYTTIYPTKCPPDPRFLVSKEGLAFCCQIIGFISLPMHFFTGYCILMKTPATMKHVKLSLVNLNIWYIISQVIVSFFITSYNFYPSLASFSVGYATALNFPTVVQICILYTINDAVHVSITLLFEIRSSLILKNRFRISSSRGRGYWLAGNFFGTVFITSPVFFNLADQNAEKMKILEAIPCPSKEFFLEPITVFATSGAWNTYLLISRSLKSIYMLQIIFFTSCCIYYLVIVKTDQVSAQTRRIQARSFYGLIIQTLIPAAFTLIPSVLISSRSAPDQLVNNLVSISYAVHIVVGSLAILLVHHPYRLFIKSIFVKSKESVIVPVVSTSMFKVIK